PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400037932
Common NameLOC102583420
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family SBP
Protein Properties Length: 320aa    MW: 34802.3 Da    PI: 7.8485
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400037932genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP1308.4e-412298278
                          -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                   SBP  2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78
                          C v+gC+adlse++eyhrrhkvCevhsk+++v+++g+ qrfCqqCsrfh+l efD++krsCr+rL++hn+rrrk+q+
  PGSC0003DMP400037932 22 CLVDGCNADLSECREYHRRHKVCEVHSKTAKVTIAGRDQRFCQQCSRFHSLVEFDDGKRSCRKRLDGHNRRRRKPQP 98
                          **************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.103.6E-321683IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.7011996IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.4E-3820101IPR004333Transcription factor, SBP-box
PfamPF031104.1E-302295IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048653Biological Processanther development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 320 aa     Download sequence    Send to blast
MESSSSSSSS KRAKAPGNIA HCLVDGCNAD LSECREYHRR HKVCEVHSKT AKVTIAGRDQ  60
RFCQQCSRFH SLVEFDDGKR SCRKRLDGHN RRRRKPQPDS MAKNSGLLFG QQGTKLLSFS  120
SQQIFPSAVV SSAWAGVVKT DSDMVLYNNQ SHMNGMDSQN SFPDSSGHSY TGGSQFQFMQ  180
GSDHSLTESS SICQPLFEHP TSAAGISSSG QKIFSSGLND IVDSDRALSL LSSAPAVTRE  240
IGLSHMVQQP ASIPRSQSQG LQYDGLSHFP FGQDFNSKPQ DSHVSNSSNP LHFHDMLQNA  300
QDGSSTSGGS QQTLAFMWD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-2922951184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17895KRSCRKRLDGHNRRRRKP
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00555DAPTransfer from AT5G50570Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755170.0HG975517.1 Solanum lycopersicum chromosome ch05, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006352164.10.0PREDICTED: squamosa promoter-binding-like protein 16
RefseqXP_006352165.10.0PREDICTED: squamosa promoter-binding-like protein 16
RefseqXP_006352166.10.0PREDICTED: squamosa promoter-binding-like protein 16
RefseqXP_015166296.10.0PREDICTED: squamosa promoter-binding-like protein 16
RefseqXP_015166297.10.0PREDICTED: squamosa promoter-binding-like protein 16
RefseqXP_015166298.10.0PREDICTED: squamosa promoter-binding-like protein 16
RefseqXP_015166299.10.0PREDICTED: squamosa promoter-binding-like protein 16
TrEMBLM1BZC80.0M1BZC8_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000563730.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA49202037
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G50670.11e-48SBP family protein
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]